Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pan troglodytes Olfactory receptor 3A2 (OR3A2)

This Recombinant Pan troglodytes Olfactory receptor 3A2 (OR3A2) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 3A2

UniProt

Q9TU97

Expression Region

1-315

Origin

Pan troglodytes (Chimpanzee)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEPEAGTNRTAVAEFILLGLVQTEEMQPVVFVLFLFAYLVTIGGNLSILAAILVEPKLHA PMYFFLGNLSVLDVGCITVTVPAMLGRLLSHKSTISYDACLSQLFFFHLLAGMDCFLLTA MAYDRFLAICWPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGPNEVNHF YCDLPQLFQLSCSSTQLNELLLFAVGFIMAGTPLVLIITSYSHVAAAVLRIRSVEGWKKA FSTCGSHLTVVCLFFGTGIFNYMRLGSEEASDKDKGVGVFNTVINPMLNPLIYSLRNPDV QGALWRIFLGRRSLT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD35 / CR1 (CR1/802), CF488A conjugate, 0.1mg/mL
BNC880802-100 1x 100 µL

CD35 / CR1 (CR1/802), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TAS2R13 Protein Vector (Human) (pPM-C-HA)
PV041259 500 ng

TAS2R13 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
Recombinant Salmonella choleraesuis Chorismate synthase (aroC)
MBS1458418-01 0.02 mg (E-Coli)

Recombinant Salmonella choleraesuis Chorismate synthase (aroC)

Sign In for Pricing
View Details
Recombinant Salmonella choleraesuis Chorismate synthase (aroC)
MBS1458418-02 0.02 mg (Yeast)

Recombinant Salmonella choleraesuis Chorismate synthase (aroC)

Sign In for Pricing
View Details
Recombinant Salmonella choleraesuis Chorismate synthase (aroC)
MBS1458418-03 0.1 mg (E-Coli)

Recombinant Salmonella choleraesuis Chorismate synthase (aroC)

Sign In for Pricing
View Details
Recombinant Salmonella choleraesuis Chorismate synthase (aroC)
MBS1458418-04 0.1 mg (Yeast)

Recombinant Salmonella choleraesuis Chorismate synthase (aroC)

Sign In for Pricing
View Details