Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 3A1 (OR3A1)

This Recombinant Human Olfactory receptor 3A1 (OR3A1) spans the amino acid sequence from region 1-315.

Product Specifications

Product Name Alternative

Olfactory receptor 3A1, Olfactory receptor 17-40, OR17-40, Olfactory receptor OR17-15

UniProt

P47881

Expression Region

1-315

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQPESGANGTVIAEFILLGLLEAPGLQPVVFVLFLFAYLVTVRGNLSILAAVLVEPKLHT PMYFFLGNLSVLDVGCISVTVPSMLSRLLSRKRAVPCGACLTQLFFFHLFVGVDCFLLTA MAYDRFLAICRPLTYSTRMSQTVQRMLVAASWACAFTNALTHTVAMSTLNFCGPNVINHF YCDLPQLFQLSCSSTQLNELLLFAVGFIMAGTPMALIVISYIHVAAAVLRIRSVEGRKKA FSTCGSHLTVVAIFYGSGIFNYMRLGSTKLSDKDKAVGIFNTVINPMLNPIIYSFRNPDV QSAIWRMLTGRRSLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Lens culinaris Lectin (Lentil) -LcH-,  30nm
GP-1401-30 1 mL

Colloidal Gold Conjugated Lens culinaris Lectin (Lentil) -LcH-, 30nm

Sign In for Pricing
View Details
Mouse MDC/CCL22 Antibody Pair Set
E-KAB-0317 50 µL & 100 µg

Mouse MDC/CCL22 Antibody Pair Set

Sign In for Pricing
View Details
CSDC2 (NM_014460) Human Recombinant Protein
TP308989 20 µg

CSDC2 (NM_014460) Human Recombinant Protein

Sign In for Pricing
View Details
7-Hydroxy Coumarin Beta-D-Glucuronide Sodium Salt
TRC-H924880-1MG 1 mg

7-Hydroxy Coumarin Beta-D-Glucuronide Sodium Salt

Sign In for Pricing
View Details
LTBR Rabbit Polyclonal Antibody
TA361312 100 µL

LTBR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG2a,  30nm
GM-301-30 1 mL

Colloidal Gold Conjugated Sheep Affinity Purified Antibody to Mouse IgG2a, 30nm

Sign In for Pricing
View Details