Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-8 (srg-8)

This Recombinant Serpentine receptor class gamma-8 (srg-8) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-8, Protein srg-8

UniProt

P46565

Expression Region

1-316

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGNSSTPNQGINCDPSYSYVMENFKYFVQVAYLAPAVFLYSRILYVVWVQHKKSYGYHP FFMVYSMVGLILVLLDIFITRLFVYVPQLCLPAAQFFISNPFLMELYYPLLNYLHCAQPF IQIFLTTNRMSSVLWPVDHEKFWKINFSRILILNLIAPFFFIWNTIISKKVLIFYFGGFY INYLKIIPWASMSLFLFIIRSAVVMITVVTTSITFWKMSHMKNRLKKSEGTLCKACAANS ICFLVPAVFEAMKVLNTDWGKHWLAYLVQPFAWDVLNVGSPLVMIFASGQLRTHAFNIKR PVLKRSNSILVSSMTN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CFAP61 Antibody
MBS1493658-01 0.05 mg

CFAP61 Antibody

Sign In for Pricing
View Details
CFAP61 Antibody
MBS1493658-02 0.1 mg

CFAP61 Antibody

Sign In for Pricing
View Details
CFAP61 Antibody
MBS1493658-03 5x 0.1 mg

CFAP61 Antibody

Sign In for Pricing
View Details
hsa-mir-144-3p RT-PCR Detection and U6 Calibration Kit
abx096496-01 50 Reactions

hsa-mir-144-3p RT-PCR Detection and U6 Calibration Kit

Sign In for Pricing
View Details
hsa-mir-144-3p RT-PCR Detection and U6 Calibration Kit
abx096496-02 100 Reactions

hsa-mir-144-3p RT-PCR Detection and U6 Calibration Kit

Sign In for Pricing
View Details
hsa-mir-144-3p RT-PCR Detection and U6 Calibration Kit
abx096496-03 200 Reactions

hsa-mir-144-3p RT-PCR Detection and U6 Calibration Kit

Sign In for Pricing
View Details