Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-4 (srg-4)

This Recombinant Serpentine receptor class gamma-4 (srg-4) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-4, Protein srg-4

UniProt

P54126

Expression Region

1-316

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQCNSSYSVTRENLKYFAQFVYLVPGVLFQLRILIVIWGTHNKIYLKSSFFTIWSLDSL VSLVQMFLDVSFTRIHIYFPQLCEGFSVFLEIHWMIPNIVYPFYLYAFTAKSVIHSFLSI NRASCVLMPTKYAYIWRSHMKKVIVFILLYPFLLLWNVIISEKYLDFIFGGFVISYIKRV PWASLSKFQIISYVFTFSVTLVTNSITLSKMAKLKKRLLMAERHLCVATAWISSGFVISL IAQAHFAFFRGDHELVEIFYIIQCVSFDLLNVGSPIVMITLSRELRNHVFLINPSPVVSR STSTFNNKNNISILIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HPSE2 Human Gene Knockout Kit (CRISPR)
KN416534 1 Kit

HPSE2 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
DDX6 (NM_004397) Human Recombinant Protein
TP309431 20 µg

DDX6 (NM_004397) Human Recombinant Protein

Sign In for Pricing
View Details
CUEDC2 Polyclonal Antibody
E-AB-14902-01 20 µL

CUEDC2 Polyclonal Antibody

Sign In for Pricing
View Details
CUEDC2 Polyclonal Antibody
E-AB-14902-02 60 µL

CUEDC2 Polyclonal Antibody

Sign In for Pricing
View Details
CUEDC2 Polyclonal Antibody
E-AB-14902-03 120 µL

CUEDC2 Polyclonal Antibody

Sign In for Pricing
View Details
CUEDC2 Polyclonal Antibody
E-AB-14902-04 200 µL

CUEDC2 Polyclonal Antibody

Sign In for Pricing
View Details