Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class gamma-4 (srg-4)

This Recombinant Serpentine receptor class gamma-4 (srg-4) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Serpentine receptor class gamma-4, Protein srg-4

UniProt

P54126

Expression Region

1-316

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSQCNSSYSVTRENLKYFAQFVYLVPGVLFQLRILIVIWGTHNKIYLKSSFFTIWSLDSL VSLVQMFLDVSFTRIHIYFPQLCEGFSVFLEIHWMIPNIVYPFYLYAFTAKSVIHSFLSI NRASCVLMPTKYAYIWRSHMKKVIVFILLYPFLLLWNVIISEKYLDFIFGGFVISYIKRV PWASLSKFQIISYVFTFSVTLVTNSITLSKMAKLKKRLLMAERHLCVATAWISSGFVISL IAQAHFAFFRGDHELVEIFYIIQCVSFDLLNVGSPIVMITLSRELRNHVFLINPSPVVSR STSTFNNKNNISILIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Propyl-D7 Paraben
TRC-P838287-5MG 5 mg

Propyl-D7 Paraben

Sign In for Pricing
View Details
CD54 / ICAM-1 (15.2), 0.2mg/mL
BNUB2853-100 1x 100 µL

CD54 / ICAM-1 (15.2), 0.2mg/mL

Sign In for Pricing
View Details
CD86 (C86/1146), CF405S conjugate, 0.1mg/mL
BNC041146-100 1x 100 µL

CD86 (C86/1146), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Blocks, Prostate
CB507126 1 Block

Frozen Tissue Blocks, Prostate

Sign In for Pricing
View Details
GNB3 (NM_002075) Human Over-expression Lysate
LY431043 100 µg

GNB3 (NM_002075) Human Over-expression Lysate

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon
CS638912 5x 5 µm

Frozen Tissue Sections, Colon

Sign In for Pricing
View Details