Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Protein lifeguard 2 (FAIM2)

This Recombinant Bovine Protein lifeguard 2 (FAIM2) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Protein lifeguard 2, Fas apoptotic inhibitory molecule 2

UniProt

Q1LZ71

Expression Region

1-316

Origin

Bos taurus (Bovine)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQGKLSVANKAPGTEGQQQANGEKKETPAVPSAPPSYEEATSGEGLKAGAFPPAPSAVP LHPSWAYVDPNSSSSYESGFPTGDHEFFTTFSWDDQKVRRVFIRKVYTILLIQLLVTLGV VALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTIFTLSMA YLTGMLSSYYNTTSVLLCLSITALVCLSVTVFSFQTKFDFTSCQGVLFVLLMTLFFSGLI LAILLPFQYVPWLHAVYAVLGAGVFTLFLAFDTQLLMGSRRHSLSPEEYIFGALNIYLDI IYIFTFFLQLFGTNRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nucleolin (NCL/902), CF647 conjugate, 0.1mg/mL
BNC470902-100 1x 100 µL

Nucleolin (NCL/902), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human Lambda Light Chain (HP6054), CF568 conjugate, 0.1mg/mL
BNC680262-100 1x 100 µL

Human Lambda Light Chain (HP6054), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL
BNC680676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD68 (LAMP4/824), CF568 conjugate, 0.1mg/mL
BNC680824-500 1x 500 µL

CD68 (LAMP4/824), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cyclin D1 (CCND1/809), CF405S conjugate, 0.1mg/mL
BNC040809-500 1x 500 µL

Cyclin D1 (CCND1/809), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF647 conjugate, 0.1mg/mL
BNC472807-500 1x 500 µL

Calretinin / Calbindin 2 (Mesothelioma Marker) (CALB2/2807), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details