Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2G6 (OR2G6)

This Recombinant Human Olfactory receptor 2G6 (OR2G6) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 2G6

UniProt

Q5TZ20

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEETNNSSEKGFLLLGFSDQPQLERFLFAIILYFYVLSLLGNTALILVCCLDSRLHTPMY FFLSNLSCVDICFTTSVAPQLLVTMNKKDKTMSYGGCVAQLYVAMGLGSSECILLAVMAY DRYAAVCRPLRYIAIMHPRFCASLAGGAWLSGLITSLIQCSLTVQLPLCGHRTLDHIFCE VPVLIKLACVDTTFNEAELFVASVVFLIVPVLLILVSYGFITQAVLRIKSAAGRQKAFGT CSSHLVVVIIFYGTIIFMYLQPANRRSKNQGKFVSLFYTIVTPLLNPIIYTLRNKDVKGA LRTLILGSAAGQSHKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Pebp4 (NM_028560) AAV Particle
MR216065A1V 250 µL

Mouse Pebp4 (NM_028560) AAV Particle

Sign In for Pricing
View Details
HBsAg protein (Subtype adw)
30R-AH016-01 0.5 mg

HBsAg protein (Subtype adw)

Sign In for Pricing
View Details
HBsAg protein (Subtype adw)
30R-AH016-02 1 mg

HBsAg protein (Subtype adw)

Sign In for Pricing
View Details
FKBP6 Polyclonal Antibody
A68278-100 100 µL

FKBP6 Polyclonal Antibody

Sign In for Pricing
View Details
Transglutaminase-1 Polyclonal Antibody, APC-Cy7 Conjugated
bs-6690R-APC-Cy7 100 µL

Transglutaminase-1 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
NOVA2 Antibody
orb1266436 400 μl

NOVA2 Antibody

Sign In for Pricing
View Details