Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2G6 (OR2G6)

This Recombinant Human Olfactory receptor 2G6 (OR2G6) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 2G6

UniProt

Q5TZ20

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEETNNSSEKGFLLLGFSDQPQLERFLFAIILYFYVLSLLGNTALILVCCLDSRLHTPMY FFLSNLSCVDICFTTSVAPQLLVTMNKKDKTMSYGGCVAQLYVAMGLGSSECILLAVMAY DRYAAVCRPLRYIAIMHPRFCASLAGGAWLSGLITSLIQCSLTVQLPLCGHRTLDHIFCE VPVLIKLACVDTTFNEAELFVASVVFLIVPVLLILVSYGFITQAVLRIKSAAGRQKAFGT CSSHLVVVIIFYGTIIFMYLQPANRRSKNQGKFVSLFYTIVTPLLNPIIYTLRNKDVKGA LRTLILGSAAGQSHKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RIPA Buffer
IBS-BR002 500 mL

RIPA Buffer

Sign In for Pricing
View Details
Prodigiosin, Serratia marcescens (NSC 47147, Casein Kinase I Inhibitor IV, 2-Methyl-3-pentyl-6-methoxyprodigiosene)
217703 200 µg

Prodigiosin, Serratia marcescens (NSC 47147, Casein Kinase I Inhibitor IV, 2-Methyl-3-pentyl-6-methoxyprodigiosene)

Sign In for Pricing
View Details
C11orf87 AAV siRNA Pooled Vector
13725161 1.0 µg

C11orf87 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
glaH Antibody
MBS7175368 Inquire

glaH Antibody

Sign In for Pricing
View Details
Phospho-IKK- Alpha (Thr23) Colorimetric Cell-Based ELISA Kit (OKAG01971)
OKAG01971 2x 96 Well

Phospho-IKK- Alpha (Thr23) Colorimetric Cell-Based ELISA Kit (OKAG01971)

Sign In for Pricing
View Details
Human FZD4 Protein, Fc Tag
KMPH6287 50 µg

Human FZD4 Protein, Fc Tag

Sign In for Pricing
View Details