Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2G6 (OR2G6)

This Recombinant Human Olfactory receptor 2G6 (OR2G6) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 2G6

UniProt

Q5TZ20

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEETNNSSEKGFLLLGFSDQPQLERFLFAIILYFYVLSLLGNTALILVCCLDSRLHTPMY FFLSNLSCVDICFTTSVAPQLLVTMNKKDKTMSYGGCVAQLYVAMGLGSSECILLAVMAY DRYAAVCRPLRYIAIMHPRFCASLAGGAWLSGLITSLIQCSLTVQLPLCGHRTLDHIFCE VPVLIKLACVDTTFNEAELFVASVVFLIVPVLLILVSYGFITQAVLRIKSAAGRQKAFGT CSSHLVVVIIFYGTIIFMYLQPANRRSKNQGKFVSLFYTIVTPLLNPIIYTLRNKDVKGA LRTLILGSAAGQSHKD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chicken Apurinic/Apyrimidinic Endonuclease 1 (APEX1) ELISA Kit-Sandwich
EK1F366-01 48 Test

Chicken Apurinic/Apyrimidinic Endonuclease 1 (APEX1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
Chicken Apurinic/Apyrimidinic Endonuclease 1 (APEX1) ELISA Kit-Sandwich
EK1F366-02 96 Tests

Chicken Apurinic/Apyrimidinic Endonuclease 1 (APEX1) ELISA Kit-Sandwich

Sign In for Pricing
View Details
LIG1 Antibody
A27500-100UL 100 µL

LIG1 Antibody

Sign In for Pricing
View Details
Sheep Polyclonal Sheep anti-Equine IgG (H+L) Secondary Antibody [DyLight 680]
NB7433FR 1 mL

Sheep Polyclonal Sheep anti-Equine IgG (H+L) Secondary Antibody [DyLight 680]

Sign In for Pricing
View Details
CD300LG HDR Plasmid (m)
sc-424647-HDR 20 µg

CD300LG HDR Plasmid (m)

Sign In for Pricing
View Details
Alpl 3'UTR Lenti-reporter-Luc Vector
11801084 1.0 µg

Alpl 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details