Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pongo abelii Protein lifeguard 2 (FAIM2)

This Recombinant Pongo abelii Protein lifeguard 2 (FAIM2) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Protein lifeguard 2, Fas apoptotic inhibitory molecule 2

UniProt

Q5R4I4

Expression Region

1-316

Origin

Pongo abelii (Sumatran orangutan)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTQGKLSVANKAPGTEGQQQVHGEKKEAPAVPSAPPSYEEATSGEGMKAGAFPPAPTAVP LHPSWAYVDPSSSSSYDNGFPTGDHELFTTFSWDDQKVRRVFVRKVYTILLIQLLVTLAV VALFTFCDPVKDYVQANPGWYWASYAVFFATYLTLACCSGPRRHFPWNLILLTVFTLSMA YLTGMLSSYYNTTSVLLCLGITALVCLSVTVFSFQTKFDFTSCQGVLFVLPMTLFFSGLI LAILLPFQYVPWLHAVYAALGAGVFTLFLALDTQLLMGNRRHSLSPEEYIFGALNIYLDI IYIFTFFLQLFGTNRE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
BNC880026-500 1x 500 µL

ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL
BNC740178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF568 conjugate, 0.1mg/mL
BNC680189-500 1x 500 µL

CD74 (BU45), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD64 (10.1), CF568 conjugate, 0.1mg/mL
BNC682846-500 1x 500 µL

CD64 (10.1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N-Cadherin / Cadherin-2 / CD325 (NCAD) (CDH2/1573), CF740 conjugate, 0.1mg/mL
BNC741573-100 1x 100 µL

N-Cadherin / Cadherin-2 / CD325 (NCAD) (CDH2/1573), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF568 conjugate, 0.1mg/mL
BNC680035-500 1x 500 µL

Calgranulin B / MRP-8/-14 / MAC 387 / S100A8/A9 / Macrophage Ag (MAC387), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details