Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4N4 (OR4N4)

This Recombinant Human Olfactory receptor 4N4 (OR4N4) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 4N4, Olfactory receptor OR15-1, Olfactory receptor OR15-5

UniProt

Q8N0Y3

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIANNTVVTEFILLGLTQSQDIQLLVFVLILIFYLIILPGNFLIIFTIRSDPGLTAPLY LFLGNLAFLDASYSFIVAPRMLVDFLSEKKVISYRGCITQLFFLHFLGGGEGLLLVVMAF DRYIAICRPLHCSTVMNPRACYAMMLALWLGGFVHSIIQVVLILRLPFCGPNQLDNFFCD VRQVIKLACTDMFVVELLMVFNSGLMTLLCFLGLLASYAVILCHVRRAASEGKNKAMSTC TTRVIIILLMFGPAIFIYMCPFRALPADKMVSLFHTVIFPLMNPMIYTLRNQEVKTSMKR LLSRHVVCQVDFIIRN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Myometrium
CS800248 5x 5 µm

Tissue FFPE Sections, Myometrium

Sign In for Pricing
View Details
Tissue Total RNA, Ileum
CR560847 5 µg

Tissue Total RNA, Ileum

Sign In for Pricing
View Details
P47 phox (Ab-304) Antibody
8B1160-AAT 50 µg

P47 phox (Ab-304) Antibody

Sign In for Pricing
View Details
EFHD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8F3]
TA812755AM 100 µL

EFHD1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8F3]

Sign In for Pricing
View Details
EIF4EBP2 (NM_004096) Human Over-expression Lysate
LY418216 100 µg

EIF4EBP2 (NM_004096) Human Over-expression Lysate

Sign In for Pricing
View Details
Freeze Dryer BFFT-304-B
BFFT-304-B 1 Unit

Freeze Dryer BFFT-304-B

Sign In for Pricing
View Details