Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 10A7 (OR10A7)

This Recombinant Human Olfactory receptor 10A7 (OR10A7) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 10A7, Olfactory receptor OR12-6

UniProt

Q8NGE5

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MICENHTRVTEFILLGFTNNPEMQVSLFIFFLAIYTVTLLGNFLIVTVTSVDLALQTPMY FFLQNLSLLEVCFTLVMVPKMLVDLVSPRKIISFVGCGTQMYFFFFFGSSECFLLSMMAY DRFVAICNPLHYSVIMNRSLCLWMAIGSWMSGVPVSMLQTAWMMALPFCGPNAVDHFFCD GPPVLKLVTVDTTMYEMQALASTLLFIMFPFCLILVSYTRIIITILRMSSATGRQKAFST CSSHLIVVSLFYGTASLTYLRPKSNQSPESKKLVSLSYTVITPMLNPIIYGLRNNEVKGA VKRTITQKVLQKLDVF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cocamidopropyl Betaine (~30% aqueous solution)
TRC-C633513-10G 10 g

Cocamidopropyl Betaine (~30% aqueous solution)

Sign In for Pricing
View Details
Calbryte™ 520, potassium salt
20656-AAT 2x 50 µg

Calbryte™ 520, potassium salt

Sign In for Pricing
View Details
FAM113B (PCED1B) (NM_138371) Human Recombinant Protein
TP303593L 1 mg

FAM113B (PCED1B) (NM_138371) Human Recombinant Protein

Sign In for Pricing
View Details
Tissue Total RNA, Breast
CR566330 5 µg

Tissue Total RNA, Breast

Sign In for Pricing
View Details
GIPC (GIPC1) (NM_202468) Human Recombinant Protein
TP324373 20 µg

GIPC (GIPC1) (NM_202468) Human Recombinant Protein

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]
E-AB-F1149M1-01 20 Tests

Elab Fluor® 700 Anti-Human CD107a/LAMP-1 Antibody[H4A3]

Sign In for Pricing
View Details