Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4C15 (OR4C15)

This Recombinant Human Olfactory receptor 4C15 (OR4C15) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 4C15, Olfactory receptor OR11-127, Olfactory receptor OR11-134

UniProt

Q8NGM1

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQNQSFVTEFVLLGLSQNPNVQEIVFVVFLFVYIATVGGNMLIVVTILSSPALLVSPMYF FLGFLSFLDACFSSVITPKMIVDSLYVTKTISFEGCMMQLFAEHFFAGVEVIVLTAMAYD RYVAICKPLHYSSIMNRRLCGILMGVAWTGGLLHSMIQILFTFQLPFCGPNVINHFMCDL YPLLELACTDTHIFGLMVVINSGFICIINFSLLLVSYAVILLSLRTHSSEGRWKALSTCG SHIAVVILFFVPCIFVYTRPPSAFSLDKMAAIFYIILNPLLNPLIYTFRNKEVKQAMRRI WNRLMVVSDEKENIKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human DIM1/TXNL4A Protein (His Tag)
PKSH030841 100 µg

Recombinant Human DIM1/TXNL4A Protein (His Tag)

Sign In for Pricing
View Details
XFD647 acid
1797-AAT 10 mg

XFD647 acid

Sign In for Pricing
View Details
Human Polyserase1 (TMPRSS9) activation kit by CRISPRa
GA117748 1 Kit

Human Polyserase1 (TMPRSS9) activation kit by CRISPRa

Sign In for Pricing
View Details
CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2761), CF568 conjugate, 0.1mg/mL
BNC682761-500 1x 500 µL

CD40 Ligand / CD154 / TRAP1 (Activation Marker of T-Lymphocytes) (CD40LG/2761), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GPR48 (LGR4) Human Gene Knockout Kit (CRISPR)
KN421345 1 Kit

GPR48 (LGR4) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), CF640R conjugate, 0.1mg/mL
BNC402368-500 1x 500 µL

Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details