Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4C15 (OR4C15)

This Recombinant Human Olfactory receptor 4C15 (OR4C15) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 4C15, Olfactory receptor OR11-127, Olfactory receptor OR11-134

UniProt

Q8NGM1

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQNQSFVTEFVLLGLSQNPNVQEIVFVVFLFVYIATVGGNMLIVVTILSSPALLVSPMYF FLGFLSFLDACFSSVITPKMIVDSLYVTKTISFEGCMMQLFAEHFFAGVEVIVLTAMAYD RYVAICKPLHYSSIMNRRLCGILMGVAWTGGLLHSMIQILFTFQLPFCGPNVINHFMCDL YPLLELACTDTHIFGLMVVINSGFICIINFSLLLVSYAVILLSLRTHSSEGRWKALSTCG SHIAVVILFFVPCIFVYTRPPSAFSLDKMAAIFYIILNPLLNPLIYTFRNKEVKQAMRRI WNRLMVVSDEKENIKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Myostatin Propeptide (MSTN) (N-term) Rabbit Polyclonal Antibody
AP11945PU-N 200 µL

Myostatin Propeptide (MSTN) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tau (S46) Antibody
KC-44527-01 50 μL

Tau (S46) Antibody

Sign In for Pricing
View Details
Tau (S46) Antibody
KC-44527-02 100 µL

Tau (S46) Antibody

Sign In for Pricing
View Details
Tau (S46) Antibody
KC-44527-03 1 mL

Tau (S46) Antibody

Sign In for Pricing
View Details
Recombinant Mouse CD8a/Lyt2 Protein (His Tag)
PKSM040706 50 µg

Recombinant Mouse CD8a/Lyt2 Protein (His Tag)

Sign In for Pricing
View Details
Propionaldehyde (>80%)
TRC-P782515-5G 5 g

Propionaldehyde (>80%)

Sign In for Pricing
View Details