Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4C15 (OR4C15)

This Recombinant Human Olfactory receptor 4C15 (OR4C15) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 4C15, Olfactory receptor OR11-127, Olfactory receptor OR11-134

UniProt

Q8NGM1

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQNQSFVTEFVLLGLSQNPNVQEIVFVVFLFVYIATVGGNMLIVVTILSSPALLVSPMYF FLGFLSFLDACFSSVITPKMIVDSLYVTKTISFEGCMMQLFAEHFFAGVEVIVLTAMAYD RYVAICKPLHYSSIMNRRLCGILMGVAWTGGLLHSMIQILFTFQLPFCGPNVINHFMCDL YPLLELACTDTHIFGLMVVINSGFICIINFSLLLVSYAVILLSLRTHSSEGRWKALSTCG SHIAVVILFFVPCIFVYTRPPSAFSLDKMAAIFYIILNPLLNPLIYTFRNKEVKQAMRRI WNRLMVVSDEKENIKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WDR21A (DCAF4) (NM_181341) Human Over-expression Lysate
LY432243 100 µg

WDR21A (DCAF4) (NM_181341) Human Over-expression Lysate

Sign In for Pricing
View Details
Ku-Holo (p70;83) (KU729), CF405S conjugate, 0.1mg/mL
BNC040729-100 1x 100 µL

Ku-Holo (p70;83) (KU729), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FLT1 Antibody
KC-758-01 50 μL

FLT1 Antibody

Sign In for Pricing
View Details
FLT1 Antibody
KC-758-02 100 µL

FLT1 Antibody

Sign In for Pricing
View Details
FLT1 Antibody
KC-758-03 1 mL

FLT1 Antibody

Sign In for Pricing
View Details
Human Mitochondrial Ferritin (FTMT) activation kit by CRISPRa
GA114320 1 Kit

Human Mitochondrial Ferritin (FTMT) activation kit by CRISPRa

Sign In for Pricing
View Details