Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 63 (Olfr63)

This Recombinant Mouse Olfactory receptor 63 (Olfr63) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 63, Odorant receptor M4, Olfactory receptor 267-1

UniProt

Q8VBW9

Expression Region

1-316

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPGQNYSTISEFILFGFSAFPHQMLPALFLLYLLMYLFTLLGNLVIMAAIWTEHRLHTPM YLFLCALSISEILFTVVITPRMLSDMLSTHRSITFIACANQLFFSFTFGYTHSFLLVVMG YDRYVAICRPLHYHALMSLQGCARLVAWSWAGGSLIGMALTIIIFHLTFCESNVIHHILC HVFSLLKLACGERTAFVTIAVILVCVTPLIGCLVFIILSYIFIVAAILRIPSTEGRHKTF STCASHLTVVIVHYGFASIIYLKSRGLYSQYTDTLMSTTYTVFTPFLSPIIFSLRNKELK NAIIKSFHRNVCQQSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tert-Butyl 2-[ (cyclopropylmethyl) amino]acetate hydrochloride
JBD32788-01 50 mg

Tert-Butyl 2-[ (cyclopropylmethyl) amino]acetate hydrochloride

Sign In for Pricing
View Details
Tert-Butyl 2-[ (cyclopropylmethyl) amino]acetate hydrochloride
JBD32788-02 0.5 g

Tert-Butyl 2-[ (cyclopropylmethyl) amino]acetate hydrochloride

Sign In for Pricing
View Details
Recombinant Human DEPTOR Protein, GST-tagged
DEPTOR-5182H 2 µg

Recombinant Human DEPTOR Protein, GST-tagged

Sign In for Pricing
View Details
Phospho-POLR2A-S5 Rabbit mAb (AMR12046N)
AMR12046N-01 50 µL

Phospho-POLR2A-S5 Rabbit mAb (AMR12046N)

Sign In for Pricing
View Details
Phospho-POLR2A-S5 Rabbit mAb (AMR12046N)
AMR12046N-02 100 µL

Phospho-POLR2A-S5 Rabbit mAb (AMR12046N)

Sign In for Pricing
View Details
TFR2 Recombinant Protein
OPCD07365-50UG 50 µg

TFR2 Recombinant Protein

Sign In for Pricing
View Details