Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 507 (Olfr507)

This Recombinant Mouse Olfactory receptor 507 (Olfr507) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 507, Olfactory receptor 204-7

UniProt

Q8VG13

Expression Region

1-316

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGILKDGNHTAVTEFILLGLTDDPVLKVVLFTIILCIYLVTVSGNLSTILLIRVSSQLHH PMYFFLSHLASVDIGISSSVTPNMLVNFLLERSTISYLGCGIQLGSGAFFGSTESFLLAA MAYDHFMAICNPLLYSTKMSTQVCIQLLVGSYIGGFLNASSFILSFFSFLFCGPNKVNHF FCDFTPLVELSCSDNSVLLILDSFSAGSIIVITVLVIAISYTYILITILKMHSTEGRHKA FSTCTSHLTAVTVFYGTVTFIYVMPKSSYSTDQNKVLSVFYMIAIAIPMLNPLIYSLRNN EIKNALKRQLSKKTFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rgs19 Mouse Gene Knockout Kit (CRISPR)
KN514735 1 Kit

Rgs19 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(20S)-Stigmasterol
TRC-S017325-50MG 50 mg

(20S)-Stigmasterol

Sign In for Pricing
View Details
LIMS1 (NM_001193482) Human Over-expression Lysate
LY434163 100 µg

LIMS1 (NM_001193482) Human Over-expression Lysate

Sign In for Pricing
View Details
Human LRRC55 activation kit by CRISPRa
GA116497 1 Kit

Human LRRC55 activation kit by CRISPRa

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD183/CXCR3 Antibody[CXCR3-173]
E-AB-F1114L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD183/CXCR3 Antibody[CXCR3-173]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD183/CXCR3 Antibody[CXCR3-173]
E-AB-F1114L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD183/CXCR3 Antibody[CXCR3-173]

Sign In for Pricing
View Details