Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2AG1 (OR2AG1)

This Recombinant Human Olfactory receptor 2AG1 (OR2AG1) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 2AG1, HT3, Olfactory receptor 2AG3, Olfactory receptor OR11-79

UniProt

Q9H205

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELWNFTLGSGFILVGILNDSGSPELLCATITILYLLALISNGLLLLAITMEARLHMPMY LLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAFMAY DRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHLLCE IPHLLKVACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHMPSNEGRKKALVT CSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTIVTPALNPLIYSLRNKEVMRA LRRVLGKYMLPAHSTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), 0.2mg/mL
BNUB2394-100 1x 100 µL

CD25 / IL2RA (Activated Lymphocyte Marker) (IL2RA/2394), 0.2mg/mL

Sign In for Pricing
View Details
RAB22A Rabbit Polyclonal Antibody
TA380618 100 µL

RAB22A Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TUBA3D (NM_080386) Human Over-expression Lysate
LY403306 100 µg

TUBA3D (NM_080386) Human Over-expression Lysate

Sign In for Pricing
View Details
Automated Rapid AST System BCMD-102
BCMD-102 Each

Automated Rapid AST System BCMD-102

Sign In for Pricing
View Details
C11orf17 (AKIP1) Mouse Monoclonal Antibody [Clone ID: OTI2E4]
CF808486 100 µg

C11orf17 (AKIP1) Mouse Monoclonal Antibody [Clone ID: OTI2E4]

Sign In for Pricing
View Details
H-Asp (t-Bu) -2-CT Polystyrene Resin
H0751503305.5G 5 g

H-Asp (t-Bu) -2-CT Polystyrene Resin

Sign In for Pricing
View Details