Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2AG1 (OR2AG1)

This Recombinant Human Olfactory receptor 2AG1 (OR2AG1) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 2AG1, HT3, Olfactory receptor 2AG3, Olfactory receptor OR11-79

UniProt

Q9H205

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELWNFTLGSGFILVGILNDSGSPELLCATITILYLLALISNGLLLLAITMEARLHMPMY LLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGGAEDLLLAFMAY DRYVAICHPLTYMTLMSSRACWLMVATSWILASLSALIYTVYTMHYPFCRAQEIRHLLCE IPHLLKVACADTSRYELMVYVMGVTFLIPSLAAILASYTQILLTVLHMPSNEGRKKALVT CSSHLTVVGMFYGAATFMYVLPSSFHSTRQDNIISVFYTIVTPALNPLIYSLRNKEVMRA LRRVLGKYMLPAHSTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Zalcitabine
TRC-Z140000-10MG 10 mg

Zalcitabine

Sign In for Pricing
View Details
1-O-Benzyl 6-O-Tosyl-D-mannose
TRC-B170685-250MG 250 mg

1-O-Benzyl 6-O-Tosyl-D-mannose

Sign In for Pricing
View Details
Human OR9Q2 activation kit by CRISPRa
GA116537 1 Kit

Human OR9Q2 activation kit by CRISPRa

Sign In for Pricing
View Details
Concanavalin A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS
MTB07F4-CON A/W 10x 96 Well Plates

Concanavalin A Coated - 96 well plates - 8 Well Strips on 12 x 8 frame - Black PS

Sign In for Pricing
View Details
Frozen Tissue Blocks, Ovary
CB503860 1 Block

Frozen Tissue Blocks, Ovary

Sign In for Pricing
View Details
Pentafluorobenzoyl Chloride
TRC-P270300-1G 1 g

Pentafluorobenzoyl Chloride

Sign In for Pricing
View Details