Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 12D3 (OR12D3)

This Recombinant Human Olfactory receptor 12D3 (OR12D3) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 12D3, Hs6M1-27, Olfactory receptor OR6-27

UniProt

Q9UGF7

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENVTTMNEFLLLGLTGVQELQPFFFGIFLIIYLINLIGNGSILVMVVLEPQLHSPMYFF LGNLSCLDISYSSVTLPKLLVNLVCSRRAISFLGCITQLHFFHFLGSTEAILLAIMAFDR FVAICNPLRYTVIMNPQVCILLAAAAWLISFFYALMHSVMTAHLSFCGSQKLNHFFYDVK PLLELACSDTLLNQWLLSIVTGSISMGAFFLTLLSCFYVIGFLLFKNRSCRILHKALSTC ASHFMVVCLFYGPVGFTYIRPASATSMIQDRIMAIMYSAVTPVLNPLIYTLRNKEVMMAL KKIFGRKLFKDWQQHH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AATOM™ 700 NHS ester
70301-AAT 1 mg

AATOM™ 700 NHS ester

Sign In for Pricing
View Details
Tissue FFPE Sections, Ovary: right
CS802325 5x 5 µm

Tissue FFPE Sections, Ovary: right

Sign In for Pricing
View Details
Mouse Cldn5 activation kit by CRISPRa
GA200755 1 Kit

Mouse Cldn5 activation kit by CRISPRa

Sign In for Pricing
View Details
LMCD1 (NM_001278234) Human Tagged ORF Clone
RG236959 10 µg

LMCD1 (NM_001278234) Human Tagged ORF Clone

Sign In for Pricing
View Details
DHRS4 (NM_021004) Human Over-expression Lysate
LY402821 100 µg

DHRS4 (NM_021004) Human Over-expression Lysate

Sign In for Pricing
View Details
ReadiUse™ CL-APC [Cross linked-Allophycocyanin] *Ammonium Sulfate-Free*
2503-AAT 1 mg

ReadiUse™ CL-APC [Cross linked-Allophycocyanin] *Ammonium Sulfate-Free*

Sign In for Pricing
View Details