Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2AG2 (OR2AG2)

This Recombinant Human Olfactory receptor 2AG2 (OR2AG2) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 2AG2

UniProt

A6NM03

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELRNSTLGSGFILVGILNDSGSPELLYATFTILYMLALTSNGLLLLAITIEARLHMPMY LLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGSAEDLLLAFMAY DRYVAICHPLKYMTLMSPRVCWIMVATSWILASLIAIGHTMYTMHLPFCVSWEIRHLLCE IPPLLKLACADTSRYELIIYVTGVTFLLLPISAIVASYTLVLFTVLRMPSNEGRKKALVT CSSHLIVVGMFYGAATFMYVLPSSFHSPKQDNIISVFYTIVTPALNPLIYSLRNKEVMRA LRRVLGKYILLAHSTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin-8 Antibody
KC-1063-01 50 μL

Cytokeratin-8 Antibody

Sign In for Pricing
View Details
Cytokeratin-8 Antibody
KC-1063-02 100 µL

Cytokeratin-8 Antibody

Sign In for Pricing
View Details
Cytokeratin-8 Antibody
KC-1063-03 1 mL

Cytokeratin-8 Antibody

Sign In for Pricing
View Details
FAAH1 (FAAH) Human Gene Knockout Kit (CRISPR)
KN210331RB 1 Kit

FAAH1 (FAAH) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZFP57 (NM_001109809) Human Over-expression Lysate
LY432292 100 µg

ZFP57 (NM_001109809) Human Over-expression Lysate

Sign In for Pricing
View Details
Diclofenac Epolamine
TRC-D436470-250MG 250 mg

Diclofenac Epolamine

Sign In for Pricing
View Details