Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2AG2 (OR2AG2)

This Recombinant Human Olfactory receptor 2AG2 (OR2AG2) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 2AG2

UniProt

A6NM03

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MELRNSTLGSGFILVGILNDSGSPELLYATFTILYMLALTSNGLLLLAITIEARLHMPMY LLLGQLSLMDLLFTSVVTPKALADFLRRENTISFGGCALQMFLALTMGSAEDLLLAFMAY DRYVAICHPLKYMTLMSPRVCWIMVATSWILASLIAIGHTMYTMHLPFCVSWEIRHLLCE IPPLLKLACADTSRYELIIYVTGVTFLLLPISAIVASYTLVLFTVLRMPSNEGRKKALVT CSSHLIVVGMFYGAATFMYVLPSSFHSPKQDNIISVFYTIVTPALNPLIYSLRNKEVMRA LRRVLGKYILLAHSTL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AccuBlue® Broad Range dsDNA Quantitation Solution
#31009 1 Kit

AccuBlue® Broad Range dsDNA Quantitation Solution

Sign In for Pricing
View Details
Human TXNRD3 activation kit by CRISPRa
GA114428 1 Kit

Human TXNRD3 activation kit by CRISPRa

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (rCELA3B/1811), Biotin conjugate, 0.1mg/mL
BNCB3435-500 1x 500 µL

CELA3B / ELA3B (Pancreatic Function Marker) (rCELA3B/1811), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acetyl CoA synthetase (ACSS2) Human Gene Knockout Kit (CRISPR)
KN204260LP 1 Kit

Acetyl CoA synthetase (ACSS2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
RPL14 Rabbit Polyclonal Antibody
TA368069 100 µL

RPL14 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS633517 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details