Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4E1 (OR4E1)

This Recombinant Human Olfactory receptor 4E1 (OR4E1) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 4E1, Olfactory receptor OR14-43

UniProt

P0C645

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEAILLNQTSLVTYFRLRGLSVNHKARIAMFSMFLIFYVLTLIGNVLIVITIIYDHRLH TPMYFFLSNLSFIDVCHSTVTVPKMLRDVWSEEKLISFDACVTQMFFLHLFACTEIFLLT VMAYDRYVAICKPLQYMIVMNWKVCVLLAVALWTGGTIHSIALTSLTIKLPYCGPDEIDN FFCDVPQVIKLACIDTPYVLEILIVSNSGLISVVCFVVLVVSYAVILVSLRQQISKGKWK ALSTCAAHLTVVTLFLGHCIFIYSRPSTSLPEDKAVSVFFTAVTPLLNPIIYTLRNEEMK SALNKLVGRKERKEEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

RRAD Recombinant Protein (Rat)
RP226925 100 µg

RRAD Recombinant Protein (Rat)

Sign In for Pricing
View Details
Recombinant Xenopus laevis POU domain, class 3, transcription factor 1-A (pou3f1-a)
MBS1117953-01 0.02 mg (E-Coli)

Recombinant Xenopus laevis POU domain, class 3, transcription factor 1-A (pou3f1-a)

Sign In for Pricing
View Details
Recombinant Xenopus laevis POU domain, class 3, transcription factor 1-A (pou3f1-a)
MBS1117953-02 0.02 mg (Yeast)

Recombinant Xenopus laevis POU domain, class 3, transcription factor 1-A (pou3f1-a)

Sign In for Pricing
View Details
Recombinant Xenopus laevis POU domain, class 3, transcription factor 1-A (pou3f1-a)
MBS1117953-03 0.1 mg (E-Coli)

Recombinant Xenopus laevis POU domain, class 3, transcription factor 1-A (pou3f1-a)

Sign In for Pricing
View Details
Recombinant Xenopus laevis POU domain, class 3, transcription factor 1-A (pou3f1-a)
MBS1117953-04 0.1 mg (Yeast)

Recombinant Xenopus laevis POU domain, class 3, transcription factor 1-A (pou3f1-a)

Sign In for Pricing
View Details
Recombinant Xenopus laevis POU domain, class 3, transcription factor 1-A (pou3f1-a)
MBS1117953-05 0.02 mg (Baculovirus)

Recombinant Xenopus laevis POU domain, class 3, transcription factor 1-A (pou3f1-a)

Sign In for Pricing
View Details