Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4E1 (OR4E1)

This Recombinant Human Olfactory receptor 4E1 (OR4E1) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 4E1, Olfactory receptor OR14-43

UniProt

P0C645

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEAILLNQTSLVTYFRLRGLSVNHKARIAMFSMFLIFYVLTLIGNVLIVITIIYDHRLH TPMYFFLSNLSFIDVCHSTVTVPKMLRDVWSEEKLISFDACVTQMFFLHLFACTEIFLLT VMAYDRYVAICKPLQYMIVMNWKVCVLLAVALWTGGTIHSIALTSLTIKLPYCGPDEIDN FFCDVPQVIKLACIDTPYVLEILIVSNSGLISVVCFVVLVVSYAVILVSLRQQISKGKWK ALSTCAAHLTVVTLFLGHCIFIYSRPSTSLPEDKAVSVFFTAVTPLLNPIIYTLRNEEMK SALNKLVGRKERKEEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BSPRY Rabbit Polyclonal Antibody (Biotin)
orb2094958 100 µL

BSPRY Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Moxonidine hydrochloride
B3314-50 50 mg

Moxonidine hydrochloride

Sign In for Pricing
View Details
Phospho-FGFR1 (Tyr653 + Tyr654) Rabbit Polyclonal Antibody (PerCP)
orb2432415 100 µL

Phospho-FGFR1 (Tyr653 + Tyr654) Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
Gallus Caveolin 1 (CAV1) ELISA Kit
MBS2701490-01 24 Strip Well

Gallus Caveolin 1 (CAV1) ELISA Kit

Sign In for Pricing
View Details
Gallus Caveolin 1 (CAV1) ELISA Kit
MBS2701490-02 48 Strip Well

Gallus Caveolin 1 (CAV1) ELISA Kit

Sign In for Pricing
View Details
Gallus Caveolin 1 (CAV1) ELISA Kit
MBS2701490-03 96 Strip Well

Gallus Caveolin 1 (CAV1) ELISA Kit

Sign In for Pricing
View Details