Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 4E1 (OR4E1)

This Recombinant Human Olfactory receptor 4E1 (OR4E1) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 4E1, Olfactory receptor OR14-43

UniProt

P0C645

Expression Region

1-316

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEEAILLNQTSLVTYFRLRGLSVNHKARIAMFSMFLIFYVLTLIGNVLIVITIIYDHRLH TPMYFFLSNLSFIDVCHSTVTVPKMLRDVWSEEKLISFDACVTQMFFLHLFACTEIFLLT VMAYDRYVAICKPLQYMIVMNWKVCVLLAVALWTGGTIHSIALTSLTIKLPYCGPDEIDN FFCDVPQVIKLACIDTPYVLEILIVSNSGLISVVCFVVLVVSYAVILVSLRQQISKGKWK ALSTCAAHLTVVTLFLGHCIFIYSRPSTSLPEDKAVSVFFTAVTPLLNPIIYTLRNEEMK SALNKLVGRKERKEEK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

hsa-miR-516b miRNA Antagomir
MNH02869 2x 5.0 nmol

hsa-miR-516b miRNA Antagomir

Sign In for Pricing
View Details
Nori® Sheep IL-36α/IL-1F6 ELISA Kit
GR116147 96 Well

Nori® Sheep IL-36α/IL-1F6 ELISA Kit

Sign In for Pricing
View Details
Olfr1463 Mouse shRNA Plasmid (Locus ID 258120)
TR511707 1 Kit

Olfr1463 Mouse shRNA Plasmid (Locus ID 258120)

Sign In for Pricing
View Details
ITIH4 Rabbit Monoclonal Antibody
E56G0624 100 µL

ITIH4 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
LDL Monoclonal Antibody, AbBy Fluor™ 488 Conjugated
bsm-2200M-BF488 100 µL

LDL Monoclonal Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Bretylium tosylate 25mg
A21798-25 25 mg

Bretylium tosylate 25mg

Sign In for Pricing
View Details