Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Olfactory receptor 6 (Olfr6)

This Recombinant Mouse Olfactory receptor 6 (Olfr6) spans the amino acid sequence from region 1-316.

Product Specifications

Product Name Alternative

Olfactory receptor 6, Odorant receptor M50, Olfactory receptor 103-16

UniProt

P34986

Expression Region

1-316

Origin

Mus musculus (Mouse)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MENITNISEFILMGFPTAPWLQILLFSIFFITYVFVLLENLVIILTVWVTGSLHKPMYYF LSTMSFLEAWYISVTVPKMLAGFLFRPNTISFLGCMTQLYFFMSLACTECVLLAAMAYDR YVAICWPLRYPVMMTTGFCVQLTISSWVSGFTISMAKVYFISRVAFCGNNVLNHFFCDVS PILKLACMNLSMAETVDFALAIVILIFPLSATVLSYGFIVSTVLQIPSATGQRKAFSTCA SHLTVVVIFYTAVIFMYVRPRAIASFNSNKLISAIYAVFTPMLNPIIYCLRNKEVKDAIR KTIAGGRAPALGESIS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PSTPIP1 Protein Lysate (Mouse) with C-HA Tag
38050034 100 µg

PSTPIP1 Protein Lysate (Mouse) with C-HA Tag

Sign In for Pricing
View Details
Slc30a6 Mouse Gene Knockout Kit (CRISPR)
KN516043 1 Kit

Slc30a6 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
B-Cell Antigen Receptor Complex-Associated Protein Alpha Chain (CD79A) Antibody
abx377634-01 50 µg

B-Cell Antigen Receptor Complex-Associated Protein Alpha Chain (CD79A) Antibody

Sign In for Pricing
View Details
B-Cell Antigen Receptor Complex-Associated Protein Alpha Chain (CD79A) Antibody
abx377634-02 100 µg

B-Cell Antigen Receptor Complex-Associated Protein Alpha Chain (CD79A) Antibody

Sign In for Pricing
View Details
SLC23A2 Protein Lysate (Rat) with C-HA Tag
43968036 100 µg

SLC23A2 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
Human Monoclonal HAI-1/HGFA Inhibitor 1 Antibody (Genentech patent anti-HGFA) [Janelia Fluor 525]
NBP3-27960JF525 0.1 mL

Human Monoclonal HAI-1/HGFA Inhibitor 1 Antibody (Genentech patent anti-HGFA) [Janelia Fluor 525]

Sign In for Pricing
View Details