Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Succinate receptor 1 (Sucnr1)

This Recombinant Mouse Succinate receptor 1 (Sucnr1) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Succinate receptor 1, G-protein coupled receptor 91

UniProt

Q99MT6

Expression Region

1-317

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQNLSCENWLATEAILNKYYLSAFYAIEFIFGLLGNVTVVFGYLFCMKNWNSSNVYLFN LSISDFAFLCTLPILIKSYANDKGTYGDVLCISNRYVLHTNLYTSILFLTFISMDRYLLM KYPFREHFLQKKEFAILISLAVWALVTLEVLPMLTFINSVPKEEGSNCIDYASSGNPEHN LIYSLCLTLLGFLIPLSVMCFFYYKMVVFLKRRSQQQATALPLDKPQRLVVLAVVIFSIL FTPYHIMRNLRIASRLDSWPQGCTQKAIKSIYTLTRPLAFLNSAINPIFYFLMGDHYREM LISKFRQYFKSLTSFRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGFR3 Antibody, mAb, Rabbit
A03559-100 100 µL

FGFR3 Antibody, mAb, Rabbit

Sign In for Pricing
View Details
Lyn Peptide
MBS543940-01 0.25 mg

Lyn Peptide

Sign In for Pricing
View Details
Lyn Peptide
MBS543940-02 5x 0.25 mg

Lyn Peptide

Sign In for Pricing
View Details
IDH2 Rabbit Polyclonal Antibody (BF488)
orb1579126 100 µL

IDH2 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
LRG1, NT (LRG1, LRG, Leucine-rich alpha-2-glycoprotein) (MaxLight 650) discontinued
037928-ML650 100 µL

LRG1, NT (LRG1, LRG, Leucine-rich alpha-2-glycoprotein) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Rat IgG2b Isotype Control
GWB-EBB1F5 0.1 mg

Rat IgG2b Isotype Control

Sign In for Pricing
View Details