Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mammuthus primigenius Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Mammuthus primigenius Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q0Q460

Expression Region

1-317

Origin

Mammuthus primigenius (Siberian woolly mammoth)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPMQGAQGRLRGSLNATPPTTPHSGLAGNQTGPWCLEVSIPDELFLSLGLVSLVENMLVV AAIAKNRNLHSPMYYFICCLAVSDLLVSVSNVLETAVMLLLEAGVLAAWAGVVQQLDNAI DVFICGSMVSSLCFLGAIAVDRYITIFYALRYHSIVTLPRARWAIATIWAASVVCSTLFI AYYDCTAVLLCLVSFFLALVVLMAVLYMHMLARACLHARSIARLHKRWRPVHQGLGLKGA ATLSILLGSFFLCWGPFFLHLTLIVLCPQHPTCSCVFKNFKLFLTLIICNSIVDPLIYAF RSQELRKTLKEVLLCSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rabbit IL10 protein (His tag)
PDMO100002-01 20 µg

Recombinant Rabbit IL10 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rabbit IL10 protein (His tag)
PDMO100002-02 100 µg

Recombinant Rabbit IL10 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rabbit IL10 protein (His tag)
PDMO100002-03 500 µg

Recombinant Rabbit IL10 protein (His tag)

Sign In for Pricing
View Details
Recombinant Rabbit IL10 protein (His tag)
PDMO100002-04 1 mg

Recombinant Rabbit IL10 protein (His tag)

Sign In for Pricing
View Details
GOLGA8B (NM_001023567) Human Over-expression Lysate
LC432325 20 µg

GOLGA8B (NM_001023567) Human Over-expression Lysate

Sign In for Pricing
View Details
Ccdc173 Mouse Gene Knockout Kit (CRISPR)
KN502687 1 Kit

Ccdc173 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details