Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-46 (srd-46)

This Recombinant Serpentine receptor class delta-46 (srd-46) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-46, Protein srd-46

UniProt

Q19508

Expression Region

1-317

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHIFLSYFYIIFFLIVFPTQLLLLYVIIFHSPKHLKTLKRIFLCNCSCQIFSMITLVLL QARQVSNLNPVELWCYGPLRYLDAIVAYTMYVLCEGTVLMSSILIFITMYVKYEAVRSIH RERSAKFSVIILSLSPLFITMSAEAYLTIEYHLPIEYQEKFSAINSNLGDHTVIGYIALD NIPAQIVFCTICGFFVIFPLIMFCLRRNIILFINSKLDLSSTTMRQQNRALINGLTLQAF LPLFCVCPIFICSFVALITKTEILLEQYFVSVVLLLPTFFEPYITFYTVSHYRKQVRIWL GKENMGSMMLVVSVSRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chorionic Gonadotropin, Human, beta (hCGb) (APC) discontinued
C5069-62-APC 100 µL

Chorionic Gonadotropin, Human, beta (hCGb) (APC) discontinued

Sign In for Pricing
View Details
Cosfroviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)
RA0822-01 100 µg

Cosfroviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)

Sign In for Pricing
View Details
Cosfroviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)
RA0822-02 1 mg

Cosfroviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)

Sign In for Pricing
View Details
Cosfroviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)
RA0822-03 5 mg

Cosfroviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)

Sign In for Pricing
View Details
Cosfroviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)
RA0822-04 10 mg

Cosfroviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)

Sign In for Pricing
View Details
Cosfroviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)
RA0822-05 25 mg

Cosfroviximab (Biosimilar Reference Antibody) (Zaire Ebolavirus Glycoprotein)

Sign In for Pricing
View Details