Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Serpentine receptor class delta-46 (srd-46)

This Recombinant Serpentine receptor class delta-46 (srd-46) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Serpentine receptor class delta-46, Protein srd-46

UniProt

Q19508

Expression Region

1-317

Origin

Caenorhabditis elegans

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLHIFLSYFYIIFFLIVFPTQLLLLYVIIFHSPKHLKTLKRIFLCNCSCQIFSMITLVLL QARQVSNLNPVELWCYGPLRYLDAIVAYTMYVLCEGTVLMSSILIFITMYVKYEAVRSIH RERSAKFSVIILSLSPLFITMSAEAYLTIEYHLPIEYQEKFSAINSNLGDHTVIGYIALD NIPAQIVFCTICGFFVIFPLIMFCLRRNIILFINSKLDLSSTTMRQQNRALINGLTLQAF LPLFCVCPIFICSFVALITKTEILLEQYFVSVVLLLPTFFEPYITFYTVSHYRKQVRIWL GKENMGSMMLVVSVSRL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-TOLLIP Antibody Picoband® Fluoro488 Conjugated
A02039-1-Fluoro488 100 µg/Vial

Anti-TOLLIP Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
GFI1 Mouse Monoclonal Antibody [Clone ID: OTI6C10]
TA807139 100 µL

GFI1 Mouse Monoclonal Antibody [Clone ID: OTI6C10]

Sign In for Pricing
View Details
Presenilin 1 Rabbit pAb, BF700 conjugated
orb2851423 100 µL

Presenilin 1 Rabbit pAb, BF700 conjugated

Sign In for Pricing
View Details
Ripk3 Mouse qPCR Primer Pair (NM_019955)
MP212533 200 Reactions

Ripk3 Mouse qPCR Primer Pair (NM_019955)

Sign In for Pricing
View Details
GRM2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated
bsm-61365R-BF405-TR 20 µL

GRM2 Recombinant Antibody, AbBy Fluor™ 405 Conjugated

Sign In for Pricing
View Details
Lentiviral human ZFYVE9 shRNA (UAS) - Lentiviral human ZFYVE9 shRNA (UAS) (25)
GTR15348656 1 Vial

Lentiviral human ZFYVE9 shRNA (UAS) - Lentiviral human ZFYVE9 shRNA (UAS) (25)

Sign In for Pricing
View Details