Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0871 (MJ0871)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0871 (MJ0871) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0871

UniProt

Q58281

Expression Region

1-317

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIVVDYITPLMESMKISAYYTIRISIIVLTTVFIVNYIMSTGIMKKLSNMLSPILRRLKV NPLSISSTLACFFSPTVGYSILAEGLKENKVNEREVIGASLANSFPSVLSHTFTFFIPVV VPILGHTGVLYVLIRLGVALAKTIIGFLYLSIISEDYSFEMPEINKLNKKENAKKSFKST IRFAKRLIPIMFFMMTLVLYLSKIGFFDYVEKFVQPITNLLNLNPNVGILALTEIMNVQA AIVMAGGFLNEGILSSKEVLIGLIIGNVLTFSTRYVKHSLPLHVSLFGAKLGTKIVMVNA AITLLLDIFIIAGLLLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nuclear Membrane Recombinant Monoclonal Mouse Antibody (2406.NM), CF®488A Conjugate, Biotium Choice (200uL)
P023-488A-200UL 1x 200 µL

Nuclear Membrane Recombinant Monoclonal Mouse Antibody (2406.NM), CF®488A Conjugate, Biotium Choice (200uL)

Sign In for Pricing
View Details
Rabphilin 3A (Ab-Ser237) Antibody
8B0563-AAT 50 µg

Rabphilin 3A (Ab-Ser237) Antibody

Sign In for Pricing
View Details
IFluor® 405-streptavidin conjugate
16952-AAT 200 µg

IFluor® 405-streptavidin conjugate

Sign In for Pricing
View Details
Rpl13 (BC085493) Mouse Tagged ORF Clone
MG202263 10 µg

Rpl13 (BC085493) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Frozen Tissue Blocks, Pleura
CB501785 1 Block

Frozen Tissue Blocks, Pleura

Sign In for Pricing
View Details
VPS41 (NM_080631) Human Over-expression Lysate
LY403311 100 µg

VPS41 (NM_080631) Human Over-expression Lysate

Sign In for Pricing
View Details