Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 2B11 (OR2B11)

This Recombinant Human Olfactory receptor 2B11 (OR2B11) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Olfactory receptor 2B11

UniProt

Q5JQS5

Expression Region

1-317

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKSDNHSFLGDSPKAFILLGVSDRPWLELPLFVVLLLSYVLAMLGNVAIILASRVDPQLH SPMYIFLSHLSFLDLCYTTTTVPQMLVNMGSSQKTISYGGCTVQYAVFHWLGCTECIVLA AMALDRYVAICKPLHYAVLMHRALCQQLVALAWLSGFGNSFVQVVLTVQLPFCGRQVLNN FFCEVPAVIKLSCADTAVNDTILAVLVAFFVLVPLALILLSYGFIARAVLRIQSSKGRHK AFGTCSSHLMIVSLFYLPAIYMYLQPPSSYSQEQGKFISLFYSIITPTLNPFTYTLRNKD MKGALRRLLARIWRLCG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ReadiUse™ Preactivated PerCP-Cy5.5 Tandem
2595-AAT 1 mg

ReadiUse™ Preactivated PerCP-Cy5.5 Tandem

Sign In for Pricing
View Details
Medium Water Purification System BDPS-401
BDPS-401 1 Unit

Medium Water Purification System BDPS-401

Sign In for Pricing
View Details
Recombinant Human CTLA4 Protein (His Tag)
PKSH033702-01 10 µg

Recombinant Human CTLA4 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human CTLA4 Protein (His Tag)
PKSH033702-02 50 µg

Recombinant Human CTLA4 Protein (His Tag)

Sign In for Pricing
View Details
CD3e, Mouse (145-2C11), CF488A conjugate, 0.1mg/mL
BNC882013-500 1x 500 µL

CD3e, Mouse (145-2C11), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Uncoated Human CD109 (Cluster of Differentiation 109) ELISA Kit
E-UNEL-H0268-01 5x 96 Tests

Uncoated Human CD109 (Cluster of Differentiation 109) ELISA Kit

Sign In for Pricing
View Details