Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kluyveromyces lactis Chitin synthase export chaperone (CHS7)

This Recombinant Kluyveromyces lactis Chitin synthase export chaperone (CHS7) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Chitin synthase export chaperone

UniProt

Q6CRM6

Expression Region

1-317

Origin

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSFGDFSKICQRTPLPLCSVVKSAKQMVLTNDTTIKNSRLDIIDLGIIPVCYARSIDVAN TMIFEIGNAFINIVAFFLLIIIIYNVRRKVTAIGRSEYSYFFQTCLVLIIFTLIVDCGVS APGSSAYPYLVSVQLGLAGACCWMLSVLGLLGFRLWEDGTFKSMLLLYGMSFGGFILNFV VSIVTFKEWIQRKSDMSTDTMGLFTVMYVINALALLIYIICLLIVSVKVLQNYWATGAIL LGVFFFVAGQVLIYAFSNNICEGMNHYLDGMFFGSLCNLFAIMMLYKNWDMSTDDDLEFS VSIDSTEYSTFNSDIKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCGB1D4 (NM_206998) Human Over-expression Lysate
LC404126 20 µg

SCGB1D4 (NM_206998) Human Over-expression Lysate

Sign In for Pricing
View Details
CD62L (SELL) Mouse Monoclonal Antibody [Clone ID: B-S13]
AM31191AF-N 200 µg

CD62L (SELL) Mouse Monoclonal Antibody [Clone ID: B-S13]

Sign In for Pricing
View Details
FITC Conjugated Goat Polyclonal Antibody to Human IgE
FA-2104-2 2 mL

FITC Conjugated Goat Polyclonal Antibody to Human IgE

Sign In for Pricing
View Details
EIF4EBP2 (NM_004096) Human Recombinant Protein
TP308664M 100 µg

EIF4EBP2 (NM_004096) Human Recombinant Protein

Sign In for Pricing
View Details
Human RNF158 (SH3RF2) activation kit by CRISPRa
GA115876 1 Kit

Human RNF158 (SH3RF2) activation kit by CRISPRa

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (DO-1), CF594 conjugate, 0.1mg/mL
BNC941658-100 1x 100 µL

P53 Tumor Suppressor Protein (DO-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details