Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52E8 (OR52E8)

This Recombinant Human Olfactory receptor 52E8 (OR52E8) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Olfactory receptor 52E8, Olfactory receptor OR11-54

UniProt

Q6IFG1

Expression Region

1-317

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGRMSTSNHTQFHPSSFLLLGIPGLEDVHIWIGVPFFFVYLVALLGNTALLFVIQTEQS LHEPMYYFLAMLDSIDLGLSTATIPKMLGIFWFNTKEISFGGCLSHMFFIHFFTAMESIV LVAMAFDRYIAICKPLRYTMILTSKIISLIAGIAVLRSLYMVVPLVFLLLRLPFCGHRII PHTYCEHMGIARLACASIKVNIRFGLGNISLLLLDVILIILSYVRILYAVFCLPSWEARL KALNTCGSHIGVILAFFTPAFFSFLTHRFGHNIPQYIHIILANLYVVVPPALNPVIYGVR TKQIRERVLRIFLKTNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TMC6, NT (TMC6, EVER1, EVIN1, Transmembrane channel-like protein 6, Epidermodysplasia verruciformis protein 1, Protein LAK-4) (PE) discontinued
042912-PE 200 µL

TMC6, NT (TMC6, EVER1, EVIN1, Transmembrane channel-like protein 6, Epidermodysplasia verruciformis protein 1, Protein LAK-4) (PE) discontinued

Sign In for Pricing
View Details
ITIC-4F 1mg
A18480-1 1 mg

ITIC-4F 1mg

Sign In for Pricing
View Details
Rabbit Melanocortin receptor 5 (MC5R) ELISA Kit
GTR10355195 96 Well

Rabbit Melanocortin receptor 5 (MC5R) ELISA Kit

Sign In for Pricing
View Details
SMEK2 AAV siRNA Pooled Vector
44446161 1.0 µg

SMEK2 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Recombinant Rat FAM69B Protein, His (Fc)-Avi-tagged
FAM69B-1916R 50 µg

Recombinant Rat FAM69B Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
11β-Hydroxyboldione
AAA89884 50 mg

11β-Hydroxyboldione

Sign In for Pricing
View Details