Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 52E8 (OR52E8)

This Recombinant Human Olfactory receptor 52E8 (OR52E8) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Olfactory receptor 52E8, Olfactory receptor OR11-54

UniProt

Q6IFG1

Expression Region

1-317

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGRMSTSNHTQFHPSSFLLLGIPGLEDVHIWIGVPFFFVYLVALLGNTALLFVIQTEQS LHEPMYYFLAMLDSIDLGLSTATIPKMLGIFWFNTKEISFGGCLSHMFFIHFFTAMESIV LVAMAFDRYIAICKPLRYTMILTSKIISLIAGIAVLRSLYMVVPLVFLLLRLPFCGHRII PHTYCEHMGIARLACASIKVNIRFGLGNISLLLLDVILIILSYVRILYAVFCLPSWEARL KALNTCGSHIGVILAFFTPAFFSFLTHRFGHNIPQYIHIILANLYVVVPPALNPVIYGVR TKQIRERVLRIFLKTNH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IFluor® 488 Anti-human CD3 Antibody *HIT3a*
10030051-AAT 500 Tests

IFluor® 488 Anti-human CD3 Antibody *HIT3a*

Sign In for Pricing
View Details
LC3 antibody
20R-2749 50 ug

LC3 antibody

Sign In for Pricing
View Details
B3GNT2 Protein Vector (Rat) (pPB-C-His)
PV255650 500 ng

B3GNT2 Protein Vector (Rat) (pPB-C-His)

Sign In for Pricing
View Details
5'-POM- (E) -Vinyl Phosphonate-2'-O-Me-rU-3'- (L) -PSM-Phosphoramidite
PA351-100 100 g

5'-POM- (E) -Vinyl Phosphonate-2'-O-Me-rU-3'- (L) -PSM-Phosphoramidite

Sign In for Pricing
View Details
C10orf31 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
13640061 1.0 µg DNA

C10orf31 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Human Inhibin B (INHB) ELISA Kit
EKN46041 96 Tests

Human Inhibin B (INHB) ELISA Kit

Sign In for Pricing
View Details