Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trachypithecus auratus Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Trachypithecus auratus Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864I7

Expression Region

1-317

Origin

Trachypithecus auratus (Javan langur)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVQGSQRRLLGSLNSTPTATPRLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV VAIARNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLRRARRVVAAIWVASVLFSTLFI AYCDHAAVLLSLVVFFLAMLVLMAVLYVHMLARACQHAQGIAQLHKRQRPAHQGVGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RSQELRRTLKKVLLCSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF131 Rabbit Polyclonal Antibody
TA369698 100 µL

ZNF131 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Bcl rambo (BCL2L13) (Center) Rabbit Polyclonal Antibody
AP14728PU-N 400 µL

Bcl rambo (BCL2L13) (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
SAMD9 Human Gene Knockout Kit (CRISPR)
KN419076 1 Kit

SAMD9 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
P2Y6 (P2RY6) (NM_001277207) Human Tagged ORF Clone
RG237472 10 µg

P2Y6 (P2RY6) (NM_001277207) Human Tagged ORF Clone

Sign In for Pricing
View Details
AFAP (AFAP1) Rabbit Polyclonal Antibody
TA373334 100 µL

AFAP (AFAP1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Spryd3 Mouse Gene Knockout Kit (CRISPR)
KN516672 1 Kit

Spryd3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details