Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trachypithecus auratus Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Trachypithecus auratus Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864I7

Expression Region

1-317

Origin

Trachypithecus auratus (Javan langur)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVQGSQRRLLGSLNSTPTATPRLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV VAIARNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLRRARRVVAAIWVASVLFSTLFI AYCDHAAVLLSLVVFFLAMLVLMAVLYVHMLARACQHAQGIAQLHKRQRPAHQGVGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RSQELRRTLKKVLLCSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAD51 Mouse Monoclonal Antibody [Clone ID: 13E4]
AM20858PU-N 50 µL

RAD51 Mouse Monoclonal Antibody [Clone ID: 13E4]

Sign In for Pricing
View Details
Bcl-2 (100/D5 + 124), Biotin conjugate, 0.1mg/mL
BNCB1234-500 1x 500 µL

Bcl-2 (100/D5 + 124), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mouse Cbfa2t3 activation kit by CRISPRa
GA200557 1 Kit

Mouse Cbfa2t3 activation kit by CRISPRa

Sign In for Pricing
View Details
MART-1 / Melan-A (MLANA/788), CF488A conjugate, 0.1mg/mL
BNC880788-500 1x 500 µL

MART-1 / Melan-A (MLANA/788), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nesvacumab Biosimilar - Research Grade
ICH5010-1mg 1 mg

Nesvacumab Biosimilar - Research Grade

Sign In for Pricing
View Details
PCR Cabinet BPCR-202
BPCR-202 1 Unit

PCR Cabinet BPCR-202

Sign In for Pricing
View Details