Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cercopithecus neglectus Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Cercopithecus neglectus Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864K1

Expression Region

1-317

Origin

Cercopithecus neglectus (Debrazza's monkey)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVQGSQRRLLGSLNSTPTAPPHLGLAANQTGTRCLEVSIPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVLFSMLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYIHMLARACQHAQGIARLHKRQCPAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKEVLLCSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF488A conjugate, 0.1mg/mL
BNC883168-100 1x 100 µL

GRP94 / HSP90B1 (Glucose-Regulated Protein 94) (Endoplasmic Reticulum Marker) (HSP90B1/3168R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ubiquitin (Autophagy Marker) (UBB/3143R), CF647 conjugate, 0.1mg/mL
BNC473143-500 1x 500 µL

Ubiquitin (Autophagy Marker) (UBB/3143R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Durvalumab Biosimilar - Research Grade
ICH5005-10mg 10 mg (2x 5 mg)

Durvalumab Biosimilar - Research Grade

Sign In for Pricing
View Details
BAG1 (NM_004323) Human Over-expression Lysate
LY401375 100 µg

BAG1 (NM_004323) Human Over-expression Lysate

Sign In for Pricing
View Details
m-Aminophenyl Tosylate-D4
TRC-A627072-50MG 50 mg

m-Aminophenyl Tosylate-D4

Sign In for Pricing
View Details
DDR2 Mouse Monoclonal Antibody [A9H5]
HA601150 100 µL

DDR2 Mouse Monoclonal Antibody [A9H5]

Sign In for Pricing
View Details