Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Saimiri oerstedii Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Saimiri oerstedii Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864H0

Expression Region

1-317

Origin

Saimiri oerstedii (Central American squirrel monkey)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPIHGAPRKLLGSLNSTPTATPKLGLAANHTGAPCLEVSIPDGLFLSLGLVSLVENVLVV AAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLEMAVVLLLEGGALATRASVVQQLHNTI DVLTCSSMLCSLCFLGAIAVDRHISIFYALRYHSIMTLPRAQRVIAAIWVASILSSTLFI TYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGITRLHKRQPPAHQGFGLRGA ATLTILLGIFFLCWGPFFLHLKLVVFCPQHLTCSCIFKNFKVFLTLIICNTIIDPLIYAF RSQELRRTLKEVLLCSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL
BNC941231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF740 conjugate, 0.1mg/mL
BNC740333-500 1x 500 µL

CD8 (RIV11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL
BNC042848-500 1x 500 µL

Fibronectin (Fn-3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD64 (10.1), CF405S conjugate, 0.1mg/mL
BNC042846-100 1x 100 µL

CD64 (10.1), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (KRT17/778), CF594 conjugate, 0.1mg/mL
BNC940778-100 1x 100 µL

Cytokeratin 17 (KRT17/778), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD66 (CEA) (CEA31), CF568 conjugate, 0.1mg/mL
BNC680670-500 1x 500 µL

CD66 (CEA) (CEA31), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details