Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trachypithecus francoisi Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Trachypithecus francoisi Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864I4

Expression Region

1-317

Origin

Trachypithecus francoisi (Francois's leaf monkey) (Presbytis francoisi)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVQGSQRRLLGSLNSTPTATPRLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV VAIARNRNLHSPMYCFICCLALSDLLVSGSNMLDTAVILLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLRRARRVVAAIWVASILFSTLFI AYCDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIAQLHKRQRPAHQGVGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RSQELRRTLKKVLLCSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tnni3 (NM_009406) Mouse Tagged ORF Clone
MG202282 10 µg

Tnni3 (NM_009406) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Adrenocorticotropic Hormone (ACTH) ELISA Kit
K072-H5 5 Plates

Adrenocorticotropic Hormone (ACTH) ELISA Kit

Sign In for Pricing
View Details
ZCCHC17 Antibody
8C17167-AAT 50 µg

ZCCHC17 Antibody

Sign In for Pricing
View Details
Tissue FFPE Sections, Brain
CS800036 5x 5 µm

Tissue FFPE Sections, Brain

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS500824 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791 +1A4), 0.2mg/mL
BNUB1203-500 1x 500 µL

Smooth Muscle Actin (ACTA2/791 +1A4), 0.2mg/mL

Sign In for Pricing
View Details