Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Presbytis comata Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Presbytis comata Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864I9

Expression Region

1-317

Origin

Presbytis comata (Grizzled leaf monkey)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVQGSQRRLLGSLNSTPTATPKLGLAANQTGAQCLEVSIPDGLFLSLGLVSLVENVLVV AAIARNRNLHSPMYCFICCLALSDLLVSGSNMLETAVILLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAMDRYISIFYALRYHSIVTLPRARGVVAAIWVASILFSTLFI AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIAQLHKRQRPAHQGVGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKKVLLCSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-500 1x 500 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL
BNC051037-500 1x 500 µL

CD44 Standard (DF1485), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF740 conjugate, 0.1mg/mL
BNC740164-500 1x 500 µL

CD28 (204.12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
BNC400043-100 1x 100 µL

P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details