Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca sylvanus Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Macaca sylvanus Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864J6

Expression Region

1-317

Origin

Macaca sylvanus (Barbary macaque)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVQGSQRRLLGSLNSTPTATPHLGLAANQTGARCLEVSVPDGLFLSLGLVSLVENVLVV TAIAKNRNLHSPMYCFICCLALSDLLVSGSNMLETAVTLLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVLCSTLFI AYYDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRLAHQGFGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLALIICNAIIDPLIYAF RSQELRRTLKEVLLCSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM13A Human qPCR Primer Pair (NM_014883)
HP228817 200 Reactions

FAM13A Human qPCR Primer Pair (NM_014883)

Sign In for Pricing
View Details
Tissue Total RNA, Thyroid gland
CR561832 5 µg

Tissue Total RNA, Thyroid gland

Sign In for Pricing
View Details
SPI1 Mouse Monoclonal Antibody [Clone ID: OTI1F3]
CF808850 100 µg

SPI1 Mouse Monoclonal Antibody [Clone ID: OTI1F3]

Sign In for Pricing
View Details
3’,5’,N2-Tri-O-acetyl 2’-Deoxyguanosine
TRC-T740000-250MG 250 mg

3’,5’,N2-Tri-O-acetyl 2’-Deoxyguanosine

Sign In for Pricing
View Details
Hydrocortisone 21-Aldehyde Hydrate (mixture of the aldehyde and the hydrated form)
TRC-H714580-25MG 25 mg

Hydrocortisone 21-Aldehyde Hydrate (mixture of the aldehyde and the hydrated form)

Sign In for Pricing
View Details
LRRC15 Human Gene Knockout Kit (CRISPR)
KN421437 1 Kit

LRRC15 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details