Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trachypithecus obscurus Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Trachypithecus obscurus Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864I5

Expression Region

1-317

Origin

Trachypithecus obscurus (Dusky leaf-monkey) (Presbytis obscura)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVQGSQRRLLGSLNSTPTATPRLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV VAIARNRNLHSPMYCFICCLALSDLLVSGSNMLETAVFLLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLRRARRVVAAIWVASVLFSTLFI AYCDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIAQLHKRQRPAHQGVGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RSQELRRTLKKVLLCSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAQ42P Protein Lysate (Human) with C-Ha Tag
48313031 100 µg

TRNAQ42P Protein Lysate (Human) with C-Ha Tag

Sign In for Pricing
View Details
VILIP1 (VSNL1) Mouse Monoclonal Antibody [Clone ID: LBI1D2]
AMM15246VCF 100 µg

VILIP1 (VSNL1) Mouse Monoclonal Antibody [Clone ID: LBI1D2]

Sign In for Pricing
View Details
Rat Glial Fibrillary Acidic Protein (GFAP) ELISA Kit
DLR-GFAP-Ra-96T 96 Tests

Rat Glial Fibrillary Acidic Protein (GFAP) ELISA Kit

Sign In for Pricing
View Details
AEBSF
40160000-4 1 g

AEBSF

Sign In for Pricing
View Details
Ap2b1 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6954202 1.0 µg DNA

Ap2b1 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Olfr373 CRISPR/Cas9 KO Plasmid (m)
sc-434672 20 µg

Olfr373 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details