Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Trachypithecus obscurus Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Trachypithecus obscurus Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864I5

Expression Region

1-317

Origin

Trachypithecus obscurus (Dusky leaf-monkey) (Presbytis obscura)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPVQGSQRRLLGSLNSTPTATPRLGLAANQTGARCLEVSIPDGLFLSLGLVSLVENVLVV VAIARNRNLHSPMYCFICCLALSDLLVSGSNMLETAVFLLLEAGALAARAAVVQQLDNVI DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLRRARRVVAAIWVASVLFSTLFI AYCDHAAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIAQLHKRQRPAHQGVGLKGA ATLTILLGIFFLCWGPFFLHLTLIVLCPQHPTCSCIFKNFNLFLTLIICNAIIDPLIYAF RSQELRRTLKKVLLCSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Gasdermin D ELISA Kit (GSDMD)
RK01517 96 Tests

Human Gasdermin D ELISA Kit (GSDMD)

Sign In for Pricing
View Details
FAM21B sgRNA CRISPR Lentivector set (Human)
K0716901 3x 1.0 µg

FAM21B sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
orb1947285-01 48 Tests

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

Sign In for Pricing
View Details
Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit
orb1947285-02 96 Tests

Rat Phospholipase A2, Group IIA (PLA2G2A) ELISA Kit

Sign In for Pricing
View Details
Kv beta 1 (KCNAB1) Human shRNA Lentiviral Particle (Locus ID 7881)
TL303835V 500 µL Each

Kv beta 1 (KCNAB1) Human shRNA Lentiviral Particle (Locus ID 7881)

Sign In for Pricing
View Details
SNCA Matched Antibody Pair Set [ABP-S-051392]
ABP-S-051392 5 Plates

SNCA Matched Antibody Pair Set [ABP-S-051392]

Sign In for Pricing
View Details