Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cat Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Cat Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q865E9

Expression Region

1-317

Origin

Felis catus (Cat) (Felis silvestris catus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSVQGPQRRLLGSLNSTSPAAPRLGLAANQTGPRCLELSVPDGLFLGLGLVSVVENVLVV AAIAKNRNLHSPMYYFICCLAVSDLLVSVSSVLETAVMLLLEAGALAGRAAVVQRLDDII DVLVCGAMVSSLCFLGAIAVDRYISIFYALRYHSIVTLPRAWRAISAIWVASVLSSTLFI AYYDHTAVLLCLVSFFVAMLVLMAVLYVHMLARACQHARGIARLHKRQRPVHQGLGLKGA ATLTILLGIFFLCWGPFFLHLSLMVLCPRHPICGCVFKNFNLFLTLIICNSIVDPFIYAF RSQELRKTLQEVLLCSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBTF antibody
FNab09194 100 µg

UBTF antibody

Sign In for Pricing
View Details
SFMBT1 (NM_001005159) Human Over-expression Lysate
LY423946 100 µg

SFMBT1 (NM_001005159) Human Over-expression Lysate

Sign In for Pricing
View Details
PKC iota (PRKCI) (NM_002740) Human Over-expression Lysate
LY400965 100 µg

PKC iota (PRKCI) (NM_002740) Human Over-expression Lysate

Sign In for Pricing
View Details
DOK1 pTyr398 Rabbit Polyclonal Antibody
AP02520PU-S 50 µL

DOK1 pTyr398 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human PDE3A activation kit by CRISPRa
GA103436 1 Kit

Human PDE3A activation kit by CRISPRa

Sign In for Pricing
View Details
Mitochondrial Marker (AE-1), CF568 conjugate, 0.1mg/mL
BNC680905-100 1x 100 µL

Mitochondrial Marker (AE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details