Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Loris tardigradus Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Loris tardigradus Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864G0

Expression Region

1-317

Origin

Loris tardigradus (Slender loris)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPAQGSQRSLLGSLNSTLMATSSLGLSANQSGPQCLEVSVPDGLFLCLGLVSLVENMLVV AAIAKNRNLHSPMYCFICCLALSDLLVSVSNVLETAVMLLLEAGALAAQATVVQQLDNII DVLVCSSMVSSLCFLGAIAMDRYISIFYALRYHSIVTLSRAQWATAAVWAAGILSSTLFI AYYDHTAVLLCLVVFFLAMLVLMAVLYAHMLTQACQHVQGITRLHKRQHLVQQGFGLKGA ATLTILLGVFLLCWGPFFLHLTLIAVCPQHPTCSCVFKNFKLFLALIICNAIVDPLIYAF RXQELRKTLKEVLLFSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-500 1x 500 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL
BNC740146-100 1x 100 µL

CD10 (CB-CALLA), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL
BNC040676-100 1x 100 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD34 (ICO-115), CF740 conjugate, 0.1mg/mL
BNC740039-100 1x 100 µL

CD34 (ICO-115), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF740 conjugate, 0.1mg/mL
BNC741035-500 1x 500 µL

CD8 (C8/1035), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Retinol Binding Protein-1 (G4E4), CF568 conjugate, 0.1mg/mL
BNC680855-500 1x 500 µL

Retinol Binding Protein-1 (G4E4), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details