Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Galago senegalensis Melanocyte-stimulating hormone receptor (MC1R)

This Recombinant Galago senegalensis Melanocyte-stimulating hormone receptor (MC1R) spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Melanocyte-stimulating hormone receptor, MSH-R, Melanocortin receptor 1, MC1-R

UniProt

Q864F9

Expression Region

1-317

Origin

Galago senegalensis (Northern lesser bushbaby) (Senegal bushbaby)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPAQGSQRSXLGSLNSTLMATPSLGLAANQSGPQCLEVSVPDGLFLCLGLVSLVENMLVV AAIAKNRNLHSPMYCFICCLALSDLLVSISNVLETAVMLLLEAGALAVGATVVQQLDNVI DVLICSSMVSSLCFLGAIAMDRYISIFYALRYHSIVTLSRAQWATAAVWAASILSSTLFI AYYDRTVVLLCLVVFFLAMLVLMAVLYAHMLTQACQHVQGITRLHKRQHLVQQGFGLKGA ATLTILLGVFLLCWGPFFLHLTLIAVCPQHPTCSCVFKNFKLFLALIICNAIVDPLIYAF RSQELRKTLKEVLLFSW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbonic Anhydrase IX (CA9/781), CF568 conjugate, 0.1mg/mL
BNC680781-100 1x 100 µL

Carbonic Anhydrase IX (CA9/781), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (PHE5), CF640R conjugate, 0.1mg/mL
BNC400461-500 1x 500 µL

Chromogranin A (PHE5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF568 conjugate, 0.1mg/mL
BNC681853-100 1x 100 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760), CF568 conjugate, 0.1mg/mL
BNC680760-500 1x 500 µL

Cytokeratin 7 (KRT7/760), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/1074), CF647 conjugate, 0.1mg/mL
BNC471017-100 1x 100 µL

SOX10 (SOX10/1074), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF405S conjugate, 0.1mg/mL
BNC042600-500 1x 500 µL

EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details