Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Olfactory receptor-like protein OLF3

This Recombinant Dog Olfactory receptor-like protein OLF3 spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein OLF3

UniProt

Q95156

Expression Region

1-317

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTGNQTWVREFVLLGLSSDWDTEVSLFVLFLITYMVTVLGNFLIILLIRLDSRLHTPMY FFLTNLSLVDVSYATSIIPQMLAHLLAAHKAIPFVSCAAQLFFSLGLGGIEFVLLAVMAY DRYVAVCDPLRYSVIMHGGLCTRLAITSWVSGSMNSLMQTVITFQLPMCTNKYIDHISCE LLAVVRLACVDTSSNEIAIMVSSIVLLMTPFCLVLLSYIQIISTILKIQSTEGRKKAFHT CASHLTVVVLCYGMAIFTYIQPRSSPSVLQEKLISLFYSVLTPMLNPMIYSVRNKEVKGA WQKLLGQLTGITSKLAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

5-Chloro-benzooxazole-2-carboxylic Acid
TRC-C385288-5MG 5 mg

5-Chloro-benzooxazole-2-carboxylic Acid

Sign In for Pricing
View Details
ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF488A conjugate, 0.1mg/mL
BNC880487-100 1x 100 µL

ODC-1 (Ornithine Decarboxylase-1) (ODC1/487), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
RUNX1T1 Human Gene Knockout Kit (CRISPR)
KN400898 1 Kit

RUNX1T1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PD L2 (PDCD1LG2) Mouse Monoclonal Antibody [Clone ID: OTI11F9]
CF806578 100 µg

PD L2 (PDCD1LG2) Mouse Monoclonal Antibody [Clone ID: OTI11F9]

Sign In for Pricing
View Details
California Red™ SE
473-AAT 5 mg

California Red™ SE

Sign In for Pricing
View Details
DOK6 Rabbit Polyclonal Antibody
TA367557 100 µL

DOK6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details