Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Olfactory receptor-like protein OLF3

This Recombinant Dog Olfactory receptor-like protein OLF3 spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein OLF3

UniProt

Q95156

Expression Region

1-317

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTGNQTWVREFVLLGLSSDWDTEVSLFVLFLITYMVTVLGNFLIILLIRLDSRLHTPMY FFLTNLSLVDVSYATSIIPQMLAHLLAAHKAIPFVSCAAQLFFSLGLGGIEFVLLAVMAY DRYVAVCDPLRYSVIMHGGLCTRLAITSWVSGSMNSLMQTVITFQLPMCTNKYIDHISCE LLAVVRLACVDTSSNEIAIMVSSIVLLMTPFCLVLLSYIQIISTILKIQSTEGRKKAFHT CASHLTVVVLCYGMAIFTYIQPRSSPSVLQEKLISLFYSVLTPMLNPMIYSVRNKEVKGA WQKLLGQLTGITSKLAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RB (PTPRC/1147), CF740 conjugate, 0.1mg/mL
BNC741147-100 1x 100 µL

CD45RB (PTPRC/1147), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS703822 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
Human ANKRD37 activation kit by CRISPRa
GA117729 1 Kit

Human ANKRD37 activation kit by CRISPRa

Sign In for Pricing
View Details
ATG5 Rabbit Polyclonal Antibody
TA373784 100 µL

ATG5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
PKC alpha (PRKCA) (C-term) Rabbit Polyclonal Antibody
AP23369PU-N 100 µg

PKC alpha (PRKCA) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
MLH1 (MutL Homolog 1) (MLH1/1324), Biotin conjugate, 0.1mg/mL
BNCB1324-100 1x 100 µL

MLH1 (MutL Homolog 1) (MLH1/1324), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details