Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dog Olfactory receptor-like protein OLF3

This Recombinant Dog Olfactory receptor-like protein OLF3 spans the amino acid sequence from region 1-317.

Product Specifications

Product Name Alternative

Olfactory receptor-like protein OLF3

UniProt

Q95156

Expression Region

1-317

Origin

Canis familiaris (Dog) (Canis lupus familiaris)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTGNQTWVREFVLLGLSSDWDTEVSLFVLFLITYMVTVLGNFLIILLIRLDSRLHTPMY FFLTNLSLVDVSYATSIIPQMLAHLLAAHKAIPFVSCAAQLFFSLGLGGIEFVLLAVMAY DRYVAVCDPLRYSVIMHGGLCTRLAITSWVSGSMNSLMQTVITFQLPMCTNKYIDHISCE LLAVVRLACVDTSSNEIAIMVSSIVLLMTPFCLVLLSYIQIISTILKIQSTEGRKKAFHT CASHLTVVVLCYGMAIFTYIQPRSSPSVLQEKLISLFYSVLTPMLNPMIYSVRNKEVKGA WQKLLGQLTGITSKLAT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF447 (ZSCAN18) (NM_001145543) Human Over-expression Lysate
LC428934 20 µg

ZNF447 (ZSCAN18) (NM_001145543) Human Over-expression Lysate

Sign In for Pricing
View Details
SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF647 conjugate, 0.1mg/mL
BNC471926-500 1x 500 µL

SOX9 / SRY-box 9 (PCRP-SOX9-1E5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
(R)-3-(4-Phenoxyphenyl)-1-(piperidin-3-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine-d4
TRC-P318772-10MG 10 mg

(R)-3-(4-Phenoxyphenyl)-1-(piperidin-3-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine-d4

Sign In for Pricing
View Details
FBXO8 Mouse Monoclonal Antibody [Clone ID: OTI3C5]
CF807551 100 µg

FBXO8 Mouse Monoclonal Antibody [Clone ID: OTI3C5]

Sign In for Pricing
View Details
Prolactin (PRL) (NM_001163558) Human Recombinant Protein
TP328768L 1 mg

Prolactin (PRL) (NM_001163558) Human Recombinant Protein

Sign In for Pricing
View Details
Human LAX1 activation kit by CRISPRa
GA110355 1 Kit

Human LAX1 activation kit by CRISPRa

Sign In for Pricing
View Details